BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphyst037k13 (312 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69003.1| hypothetical protein [Vitis vinifera] >gi|157344... 78 2e-13 dbj|BAD94384.1| ketol-acid reductoisomerase [Arabidopsis thaliana] 77 3e-13 ref|NP_191420.1| ketol-acid reductoisomerase [Arabidopsis thalia... 77 3e-13 gb|ABR25710.1| chloroplast reductoisomerase precursor [Oryza sat... 76 6e-13 gb|EAZ35357.1| hypothetical protein OsJ_018840 [Oryza sativa (ja... 76 6e-13 >emb|CAN69003.1| hypothetical protein [Vitis vinifera] emb|CAO69862.1| unnamed protein product [Vitis vinifera] Length = 588 Score = 78.2 bits (191), Expect = 2e-13 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +3 Query: 3 MSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 116 +SDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS Sbjct: 550 LSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 587 >dbj|BAD94384.1| ketol-acid reductoisomerase [Arabidopsis thaliana] Length = 344 Score = 77.4 bits (189), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 6 SDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 116 SDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS Sbjct: 307 SDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 343 >ref|NP_191420.1| ketol-acid reductoisomerase [Arabidopsis thaliana] ref|NP_001078309.1| ketol-acid reductoisomerase [Arabidopsis thaliana] sp|Q05758|ILV5_ARATH Ketol-acid reductoisomerase, chloroplast precursor (Acetohydroxy-acid reductoisomerase) (Alpha-keto-beta-hydroxylacil reductoisomerase) gb|AAG40022.1|AF324671_1 AT3g58610 [Arabidopsis thaliana] gb|AAG42917.1|AF329500_1 putative ketol-acid reductoisomerase [Arabidopsis thaliana] emb|CAA49506.1| ketol-acid reductoisomerase [Arabidopsis thaliana] emb|CAB68199.1| ketol-acid reductoisomerase [Arabidopsis thaliana] gb|AAL32973.1| AT3g58610/F14P22_200 [Arabidopsis thaliana] gb|AAL38839.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gb|AAM20206.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gb|AAN31816.1| putative ketol-acid reductoisomerase [Arabidopsis thaliana] gb|AAN33197.1| At3g58610/F14P22_200 [Arabidopsis thaliana] Length = 591 Score = 77.4 bits (189), Expect = 3e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 6 SDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 116 SDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS Sbjct: 554 SDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 590 >gb|ABR25710.1| chloroplast reductoisomerase precursor [Oryza sativa (indica cultivar-group)] Length = 206 Score = 76.3 bits (186), Expect = 6e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 MSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 116 MSDPVHGAIEVCA+LRPTVDISVPA+ADFVRPELRQSS Sbjct: 169 MSDPVHGAIEVCAELRPTVDISVPANADFVRPELRQSS 206 >gb|EAZ35357.1| hypothetical protein OsJ_018840 [Oryza sativa (japonica cultivar-group)] Length = 509 Score = 76.3 bits (186), Expect = 6e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 3 MSDPVHGAIEVCAQLRPTVDISVPADADFVRPELRQSS 116 MSDPVHGAIEVCA+LRPTVDISVPA+ADFVRPELRQSS Sbjct: 472 MSDPVHGAIEVCAELRPTVDISVPANADFVRPELRQSS 509