BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphyst025m02 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD10255.1| putative dolichol-phosphate (beta-D) mannosyltra... 107 2e-22 emb|CAO63341.1| unnamed protein product [Vitis vinifera] 100 3e-20 ref|NP_177574.1| dolichol phosphate-mannose biosynthesis regulat... 100 5e-20 gb|ABK24118.1| unknown [Picea sitchensis] 95 1e-18 gb|EDQ55359.1| predicted protein [Physcomitrella patens subsp. p... 85 2e-15 >dbj|BAD10255.1| putative dolichol-phosphate (beta-D) mannosyltransferase 2 [Oryza sativa (japonica cultivar-group)] Length = 82 Score = 107 bits (267), Expect = 2e-22 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = +3 Query: 138 MELGDKAVGFLLTVISMSIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIP 296 MELGDKAVGF+LT+ S+SIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIP Sbjct: 1 MELGDKAVGFILTLTSLSIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIP 53 >emb|CAO63341.1| unnamed protein product [Vitis vinifera] Length = 80 Score = 100 bits (249), Expect = 3e-20 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = +3 Query: 138 MELGDKAVGFLLTVISMSIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIP 296 MEL D+AVGFLL+ IS+SIF YYTFWVIILPFVDSDHF+HKYFLPQ+YAILIP Sbjct: 1 MELADRAVGFLLSFISISIFAYYTFWVIILPFVDSDHFIHKYFLPQDYAILIP 53 >ref|NP_177574.1| dolichol phosphate-mannose biosynthesis regulatory protein-related [Arabidopsis thaliana] gb|AAG52357.1|AC011765_9 putative dolichyl-phosphate mannosyltransferase polypeptide 2; 4974-4608 [Arabidopsis thaliana] gb|AAO44004.1| At1g74340 [Arabidopsis thaliana] dbj|BAD43171.1| putative dolichyl-phosphate mannosyltransferase polypeptide 2 [Arabidopsis thaliana] dbj|BAE99946.1| putative dolichyl-phosphate mannosyltransferase polypeptide 2 [Arabidopsis thaliana] Length = 80 Score = 99.8 bits (247), Expect = 5e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = +3 Query: 138 MELGDKAVGFLLTVISMSIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIP 296 MEL D+AVG LL+ IS+SIFTYYTFWVIILPFVDSDHF+HKYFLPQ+YAIL+P Sbjct: 1 MELADRAVGLLLSSISLSIFTYYTFWVIILPFVDSDHFIHKYFLPQDYAILVP 53 >gb|ABK24118.1| unknown [Picea sitchensis] Length = 80 Score = 95.1 bits (235), Expect = 1e-18 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = +3 Query: 138 MELGDKAVGFLLTVISMSIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIP 296 MELGDKA+GF L S S+F YYTFWV+ILPF+D DHFVHKYFLP+EYAI+IP Sbjct: 1 MELGDKAIGFFLLTFSFSLFAYYTFWVVILPFMDGDHFVHKYFLPKEYAIIIP 53 >gb|EDQ55359.1| predicted protein [Physcomitrella patens subsp. patens] Length = 87 Score = 84.7 bits (208), Expect = 2e-15 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = +3 Query: 138 MELGDKAVGFLLTVISMSIFTYYTFWVIILPFVDSDHFVHKYFLPQEYAILIP 296 MELGDKA G LL + S ++F YYTFWVII PFVDSDHFVH YF +EYAI+IP Sbjct: 1 MELGDKAAGCLLLLFSTTLFAYYTFWVIITPFVDSDHFVHSYFPAREYAIIIP 53