BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphyst016l24 (784 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ37881.1| hypothetical protein OsJ_021364 [Oryza sativa (ja... 75 6e-12 >gb|EAZ37881.1| hypothetical protein OsJ_021364 [Oryza sativa (japonica cultivar-group)] Length = 775 Score = 74.7 bits (182), Expect = 6e-12 Identities = 41/62 (66%), Positives = 44/62 (70%), Gaps = 3/62 (4%) Frame = +1 Query: 274 GILNLHQDVQTCGYQDVQVMWSMLSSEKEVAGTPKQRKRPFWRLP-PFW--AVRLPRAAA 444 GIL+LHQDVQTCGY+DVQVMW+MLSSEKE A P RKR WRL P W AV PR Sbjct: 701 GILDLHQDVQTCGYEDVQVMWNMLSSEKE-AAPPPPRKRALWRLRLPVWPAAVWSPRGRG 759 Query: 445 AQ 450 Q Sbjct: 760 MQ 761