BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphyst013p11 (549 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAY91153.1| hypothetical protein OsI_012386 [Oryza sativa (in... 75 3e-12 ref|NP_001050739.1| Os03g0639800 [Oryza sativa (japonica cultiva... 75 3e-12 >gb|EAY91153.1| hypothetical protein OsI_012386 [Oryza sativa (indica cultivar-group)] gb|EAZ27897.1| hypothetical protein OsJ_011380 [Oryza sativa (japonica cultivar-group)] Length = 194 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 124 MNIFKKKVDPKEALRTSKREMTVATRGVEREIGSLQME 237 MNIFKKKVDPKEALRTSKREM+VATRGVEREIGSLQME Sbjct: 1 MNIFKKKVDPKEALRTSKREMSVATRGVEREIGSLQME 38 >ref|NP_001050739.1| Os03g0639800 [Oryza sativa (japonica cultivar-group)] gb|AAT85290.1| SNF7 family protein [Oryza sativa (japonica cultivar-group)] gb|ABF97820.1| SNF7 family protein, expressed [Oryza sativa (japonica cultivar-group)] dbj|BAF12653.1| Os03g0639800 [Oryza sativa (japonica cultivar-group)] Length = 229 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 124 MNIFKKKVDPKEALRTSKREMTVATRGVEREIGSLQME 237 MNIFKKKVDPKEALRTSKREM+VATRGVEREIGSLQME Sbjct: 1 MNIFKKKVDPKEALRTSKREMSVATRGVEREIGSLQME 38