BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphyst007f18 (901 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ37469.1| hypothetical protein OsJ_020952 [Oryza sativa (ja... 84 3e-17 >gb|EAZ37469.1| hypothetical protein OsJ_020952 [Oryza sativa (japonica cultivar-group)] Length = 966 Score = 84.3 bits (207), Expect(2) = 3e-17 Identities = 40/62 (64%), Positives = 51/62 (82%) Frame = -3 Query: 773 FVEEELPDHVGDIVDPNLMPTREDKERDQNSLLHKEAALSCLTSILRVGMLCSKKLPDDA 594 FVEE LPD V D+VD NL+ RED E D N+LL+KEAAL+C+TSILRVG+LCSK+LP + Sbjct: 888 FVEEALPDSVEDVVDQNLILPREDTEMDHNTLLNKEAALACITSILRVGILCSKQLPTER 947 Query: 593 LE 588 ++ Sbjct: 948 VQ 949 Score = 26.6 bits (57), Expect(2) = 3e-17 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 816 PTEENFAEDFNLHSF 772 PTE+NF E+ NLH F Sbjct: 874 PTEQNFEENTNLHRF 888