BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphylf044i10 (1000 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ27791.1| hypothetical protein OsJ_011274 [Oryza sativa (ja... 78 1e-12 gb|EAY91010.1| hypothetical protein OsI_012243 [Oryza sativa (in... 78 1e-12 gb|ABF97639.1| HEAT repeat family protein [Oryza sativa (japonic... 78 1e-12 gb|AAT77034.1| hypothetical protein [Oryza sativa (japonica cult... 78 1e-12 >gb|EAZ27791.1| hypothetical protein OsJ_011274 [Oryza sativa (japonica cultivar-group)] Length = 1012 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 116 HNTDDSMHDFKMLLLRCFISPLFLKAEEGRKLLALVLEVSEGLTKEG 256 ++ DDS+ DFKMLLLRCF+SPLFLKAEEGRKLL+LVL VSEGL +EG Sbjct: 49 YDDDDSISDFKMLLLRCFVSPLFLKAEEGRKLLSLVLGVSEGLAREG 95 >gb|EAY91010.1| hypothetical protein OsI_012243 [Oryza sativa (indica cultivar-group)] Length = 1132 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 116 HNTDDSMHDFKMLLLRCFISPLFLKAEEGRKLLALVLEVSEGLTKEG 256 ++ DDS+ DFKMLLLRCF+SPLFLKAEEGRKLL+LVL VSEGL +EG Sbjct: 138 YDDDDSISDFKMLLLRCFVSPLFLKAEEGRKLLSLVLGVSEGLAREG 184 >gb|ABF97639.1| HEAT repeat family protein [Oryza sativa (japonica cultivar-group)] Length = 1182 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 116 HNTDDSMHDFKMLLLRCFISPLFLKAEEGRKLLALVLEVSEGLTKEG 256 ++ DDS+ DFKMLLLRCF+SPLFLKAEEGRKLL+LVL VSEGL +EG Sbjct: 188 YDDDDSISDFKMLLLRCFVSPLFLKAEEGRKLLSLVLGVSEGLAREG 234 >gb|AAT77034.1| hypothetical protein [Oryza sativa (japonica cultivar-group)] Length = 496 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +2 Query: 116 HNTDDSMHDFKMLLLRCFISPLFLKAEEGRKLLALVLEVSEGLTKEG 256 ++ DDS+ DFKMLLLRCF+SPLFLKAEEGRKLL+LVL VSEGL +EG Sbjct: 188 YDDDDSISDFKMLLLRCFVSPLFLKAEEGRKLLSLVLGVSEGLAREG 234