BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphylf043a11 (1697 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ04697.1| hypothetical protein OsI_025929 [Oryza sativa (in... 68 8e-16 gb|EAZ40648.1| hypothetical protein OsJ_024131 [Oryza sativa (ja... 68 8e-16 gb|AAU89244.1| von Willebrand factor type A domain containing pr... 60 5e-15 gb|EAZ27278.1| hypothetical protein OsJ_010761 [Oryza sativa (ja... 60 5e-15 gb|ABF96527.1| von Willebrand factor type A domain containing pr... 60 5e-15 >gb|EAZ04697.1| hypothetical protein OsI_025929 [Oryza sativa (indica cultivar-group)] Length = 880 Score = 67.8 bits (164), Expect(2) = 8e-16 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 848 NLLPKVFMKREKIQLTVNSGVSKEVLLQGTSHPLRKK 958 N LPKVFMKREKIQLTVNSG SKEVLLQGTSHPL++K Sbjct: 335 NPLPKVFMKREKIQLTVNSGFSKEVLLQGTSHPLKEK 371 Score = 42.0 bits (97), Expect(2) = 8e-16 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 954 KSRQGDQKLSLVHEEDVESWSNKDFTFAYSV 1046 K RQG+ KLS HE VE+WS+KDF F+YSV Sbjct: 371 KGRQGE-KLSFRHEATVENWSSKDFNFSYSV 400 >gb|EAZ40648.1| hypothetical protein OsJ_024131 [Oryza sativa (japonica cultivar-group)] Length = 772 Score = 67.8 bits (164), Expect(2) = 8e-16 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +2 Query: 848 NLLPKVFMKREKIQLTVNSGVSKEVLLQGTSHPLRKK 958 N LPKVFMKREKIQLTVNSG SKEVLLQGTSHPL++K Sbjct: 227 NPLPKVFMKREKIQLTVNSGFSKEVLLQGTSHPLKEK 263 Score = 42.0 bits (97), Expect(2) = 8e-16 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +3 Query: 954 KSRQGDQKLSLVHEEDVESWSNKDFTFAYSV 1046 K RQG+ KLS HE VE+WS+KDF F+YSV Sbjct: 263 KGRQGE-KLSFRHEATVENWSSKDFNFSYSV 292 >gb|AAU89244.1| von Willebrand factor type A domain containing protein [Oryza sativa (japonica cultivar-group)] gb|EAY90406.1| hypothetical protein OsI_011639 [Oryza sativa (indica cultivar-group)] Length = 801 Score = 59.7 bits (143), Expect(2) = 5e-15 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = +2 Query: 848 NLLPKVFMKREKIQLTVNSGVSKEVLLQGTSHPLRKK 958 N LPKVFMK+EKIQLT+NSGVS E++L+G+SHPL+++ Sbjct: 225 NPLPKVFMKKEKIQLTLNSGVSNEIVLKGSSHPLKER 261 Score = 47.4 bits (111), Expect(2) = 5e-15 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 954 KSRQGDQKLSLVHEEDVESWSNKDFTFAYSV 1046 +SRQG+ KLS HE VE+WSNKDFTFAYSV Sbjct: 261 RSRQGE-KLSFFHEAVVENWSNKDFTFAYSV 290 >gb|EAZ27278.1| hypothetical protein OsJ_010761 [Oryza sativa (japonica cultivar-group)] Length = 768 Score = 59.7 bits (143), Expect(2) = 5e-15 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = +2 Query: 848 NLLPKVFMKREKIQLTVNSGVSKEVLLQGTSHPLRKK 958 N LPKVFMK+EKIQLT+NSGVS E++L+G+SHPL+++ Sbjct: 192 NPLPKVFMKKEKIQLTLNSGVSNEIVLKGSSHPLKER 228 Score = 47.4 bits (111), Expect(2) = 5e-15 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 954 KSRQGDQKLSLVHEEDVESWSNKDFTFAYSV 1046 +SRQG+ KLS HE VE+WSNKDFTFAYSV Sbjct: 228 RSRQGE-KLSFFHEAVVENWSNKDFTFAYSV 257 >gb|ABF96527.1| von Willebrand factor type A domain containing protein, expressed [Oryza sativa (japonica cultivar-group)] Length = 751 Score = 59.7 bits (143), Expect(2) = 5e-15 Identities = 26/37 (70%), Positives = 35/37 (94%) Frame = +2 Query: 848 NLLPKVFMKREKIQLTVNSGVSKEVLLQGTSHPLRKK 958 N LPKVFMK+EKIQLT+NSGVS E++L+G+SHPL+++ Sbjct: 225 NPLPKVFMKKEKIQLTLNSGVSNEIVLKGSSHPLKER 261 Score = 47.4 bits (111), Expect(2) = 5e-15 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +3 Query: 954 KSRQGDQKLSLVHEEDVESWSNKDFTFAYSV 1046 +SRQG+ KLS HE VE+WSNKDFTFAYSV Sbjct: 261 RSRQGE-KLSFFHEAVVENWSNKDFTFAYSV 290