BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphyem113d14 (1260 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAT92070.2| hypothetical protein SNOG_00575 [Phaeosphaeria no... 85 1e-14 >gb|EAT92070.2| hypothetical protein SNOG_00575 [Phaeosphaeria nodorum SN15] Length = 293 Score = 84.7 bits (208), Expect = 1e-14 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = +1 Query: 832 GRAMGKPGQPEWQRQALSMFKEYAVPLIKKEGQKYIAKQMGGMGKR 969 GRA+GKPGQPEWQRQA+ MFK+YA+P+IKKEGQKYIAKQM G G++ Sbjct: 247 GRAVGKPGQPEWQRQAMGMFKDYALPIIKKEGQKYIAKQMSGFGQK 292