BLASTX 2.2.17 Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bphyem001n15 (273 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 5,815,196 sequences; 2,006,227,497 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP76507.1| carboxypeptidase D [Triticum aestivum] 85 1e-15 sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 precursor (Serine... 83 7e-15 pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase... 83 7e-15 emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum] 82 1e-14 emb|CAA70815.1| serine carboxypeptidase II, CP-MII [Hordeum vulg... 80 3e-14 >gb|AAP76507.1| carboxypeptidase D [Triticum aestivum] Length = 123 Score = 85.1 bits (209), Expect = 1e-15 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = +2 Query: 2 YKGLTLVTVRGAGHLVPLHRPRQALILFQHFLKGKPMPSQTRNGTMA 142 YKGLTLV+VRGAGH VPLHRPRQAL+LFQ+FL+GKPMP QT+N T+A Sbjct: 77 YKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNATLA 123 >sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 precursor (Serine carboxypeptidase II) (Carboxypeptidase D) (CPDW-II) (CP-WII) [Contains: Serine carboxypeptidase 2 chain A (Serine carboxypeptidase II chain A); Serine carboxypeptidase 2 chain B (Serine carboxypeptidase II chain B)] Length = 444 Score = 82.8 bits (203), Expect = 7e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +2 Query: 2 YKGLTLVTVRGAGHLVPLHRPRQALILFQHFLKGKPMPSQTRNGT 136 YKGLTLV+VRGAGH VPLHRPRQAL+LFQ+FL+GKPMP QT+N T Sbjct: 400 YKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT 444 >pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature pdb|1BCS|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Chymostatin, And Arginine At 100 Degrees Kelvin prf||1408164B CPase II B Length = 160 Score = 82.8 bits (203), Expect = 7e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +2 Query: 2 YKGLTLVTVRGAGHLVPLHRPRQALILFQHFLKGKPMPSQTRNGT 136 YKGLTLV+VRGAGH VPLHRPRQAL+LFQ+FL+GKPMP QT+N T Sbjct: 116 YKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQTKNAT 160 >emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum] Length = 260 Score = 81.6 bits (200), Expect = 1e-14 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = +2 Query: 2 YKGLTLVTVRGAGHLVPLHRPRQALILFQHFLKGKPMPSQTRNGTMA 142 YKGLTLV+VRGAGH VPLHRPRQAL+LFQ+FL+GKPMP Q N T+A Sbjct: 214 YKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGKPMPGQATNATVA 260 >emb|CAA70815.1| serine carboxypeptidase II, CP-MII [Hordeum vulgare subsp. vulgare] Length = 476 Score = 80.5 bits (197), Expect = 3e-14 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +2 Query: 2 YKGLTLVTVRGAGHLVPLHRPRQALILFQHFLKGKPMPSQTRNGTMA 142 YKGLTLV+VRGAGH VPLHRPRQALILFQ FL+GKPMP +T N T+A Sbjct: 430 YKGLTLVSVRGAGHEVPLHRPRQALILFQQFLQGKPMPGRTTNVTVA 476